GLP-1/Glucagon-Like Peptide, human
GLP-1/Glucagon-Like Peptide, human
Online Inquiry
| CAT# | G16010 |
| M.F/Formula | C186H275N51O59 |
| M.W/Mr. | 4169.6 |
| Sequence | DEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| CAT# |
Product Name |
M.W |
Molecular Formula |
Inquiry |
| G05009 |
Glucagon (1 - 29), bovine, human, porcine, FAM- - labeled |
|
|
Inquiry |
| G16001 |
Glucagon - Like Peptide 1, GLP - 1 (7 - 17) - Cys |
|
|
Inquiry |
| G16002 |
Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human |
|
|
Inquiry |
| G05002 |
Glucagon (19-29), human |
|
|
Inquiry |
| G16006 |
GLP-2, human |
|
|
Inquiry |
Write a review
Ask a question
My Review for GLP-1/Glucagon-Like Peptide, human
Required fields are marked with *
×
Ask a Question for GLP-1/Glucagon-Like Peptide, human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
