GIP (human)
Gastric Inhibitory Peptide (GIP), human is thought to act as an inhibitor of gastric functions.
Online Inquiry
| CAT# | R1092 |
| Chemical Structure |  |
| CAS | 100040-31-1 |
| M.F/Formula | C226H338N60O66S |
| M.W/Mr. | 4983.58 |
| Sequence | One Letter Code: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Three Letter Code: Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln |
| Appearance | White lyophilized solid |
| Biological Activity | Potent insulinotropic hormone synthesized by duodenal K-cells. High affinity GIP receptor agonist (EC50 = 0.81 nM) that inhibits gastric acid secretion and stimulates pancreatic insulin release in response to glucose. Also affects lipid metabolism and displays mitogenic and antiapoptotic effects in pancreatic β-cells. |
| Storage | Desiccate at -20°C |
Solubility | Soluble to 1 mg/ml in water |
Shipping Condition | Room temperature in continental US; may vary elsewhere. |
Write a review
Ask a question
My Review for GIP (human)
Required fields are marked with *
×
Ask a Question for GIP (human)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
