CAT# | G02005 |
M.F/Formula | C195H287N49O57S1 |
M.W/Mr. | 4261.82 |
Sequence | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDW |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Obestatin is a 23-amino acid peptide hormone produced in specific epithelial cells of the stomach and small inte ...
Tertiapin-Q (TPN-Q) is a small compact protein that contains twenty-one amino acids, which derived from bee veno ...
GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...
Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...
Cetrorelix acetate (C70H92ClN17O14, referred to as cetrorelix), a synthetic decapeptide with 5 amino acids in th ...