Keywords Search Google Search Search

Exendin (4-39)

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	E10008
M.W/Mr.	3863.3
Sequence	GTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

CAT#	Product Name	Inquiry
CAD-110	Endo-38a-Pro-Exenatide	Inquiry
E10005	Exendin-4 (3-39)	Inquiry
E10004	Des His1, Glu8 Exendin-4	Inquiry
E10011	Glicentin-Related Peptide (21-50), human	Inquiry
E10001	Exendin (9-39)	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Inhibitors of Aspartic Proteases-Acetyl Pepstatin

Acetyl pepstatin, nature products of yeast fermentation, is general inhibitors of the family of aspartic proteas ...

The application of nafarelin acetate in hormonal therapy

Nafarelin acetate is a gonadotropin-releasing hormone (GnRH) agonist which is as effective as danazol in the tre ...

Tripeptide-10 Citrulline, a substitute of decorin

An overview of Tripeptide-10 Citrulline Signal oligopeptides are commonly synthesized from portions of EMPs and from natural ...

What is peptide YY?

The pancreatic polypeptide (PP) family includes three endogenous peptides: PP, peptides-neuropeptide Y (NYP) and ...

Palmitoyl Tripeptide-1

Palmitoyl Tripeptide-1 is also called Part of Matrixyl 3000. Palmitoyl Oligopeptide and Pal-GHK are believed to be able to st ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: