CAT# | E05025 |
M.W/Mr. | 3465.1 |
Sequence | YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Proteolytic Processing of APP Following discovery of the full-length APP cDNA clone, numerous studies were undertaken to dete ...
PBP 10 (RhoB-Glu-Arg-Leu-Phe-Glc-Val-Lys-Glc-Arg-Arg) is a 10-aa-long rhodamine-linked and membrane-permeable pe ...
Ecallantide, sold under the trade name Kalbitor, is a plasma kallikrein inhibitor, consisting of sixty amino aci ...
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...