CAT# | AF2040 |
Sequence | GTLPCGESCVWIPCISSVVGCSCKSKVCYKD |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...
Leuprolide acetate, an acetate salt with similar structure to luteinizing hormone-releasing hormone (LHRH) secre ...
The peptide neuroprotectant Tat-NR2B9c, also known as NA-1, is a Tat peptide consisting of the nine C-terminal ...
Gonadorelin acetate, a synthetic decapeptide with sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2, is a gon ...