CAT# | AF2040 |
Sequence | GTLPCGESCVWIPCISSVVGCSCKSKVCYKD |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...
of Tripeptide-1 The tripeptide-1 (glycyl-L-histadyl-L-lysine or GHK) is primarily known as carrier peptides. It ...
Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...
Thymosin Thymosin is a hormone secreted from the thymus. This is the reason why it is named Thymosin. But most are now known ...
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...