CAT# | AF2887 |
Sequence | KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Propofol, known as 2,6-Diisopropyl phenol, is mainly used in the induction and maintenance of general anesthesia ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...
Ganirelix, a synthetic decapeptide compound, is a gonadotrophin-releasing hormone (GnRH) antagonist preparation ...
Peptides are compounds formed by linking α-amino acids by peptide bonds, and are intermediate products of proteolysis. They a ...