CAT# | AF2851 |
Sequence | QGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLAPQIKCCR |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
ProTx II, a 30-amino acid, disulfide-rich peptide toxin, isolated from the venom of the tarantula, Thrixopelma ...
Purotoxin 1, a component from the venom of Geolycosa spiders, exerts selective inhibitory action on P2X3 recep ...
Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...
What are collagen peptides? Collagen peptides are repair collagen, and the protein slowly decreases with age. It can be see ...
Jingzhaotoxin-III (β-TRTX-Cj1α) is a kind of sodium channel gating modifier which is from the tarantula Chilobra ...