Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 3867.4 |
Sequence | RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
Length | 36 |
2. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
3. High fat diet and GLP-1 drugs induce pancreatic injury in mice
5. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.