Keywords Search Google Search Search

Beta-Amyloid (1-33)-Ala

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	A13229
M.W/Mr.	3745.1
Sequence	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGA

CAT#	Product Name	Inquiry
CAD-024	(Nle³⁵)-Amyloid β-Protein (1-40) ammonium salt	Inquiry
A13136	Beta-Amyloid (13-29)-Gly-Cys	Inquiry
A13025	Cys-beta-Amyloid (25-35)	Inquiry
CAD-028	(Nle³⁵)-Amyloid β-Protein (1-42) ammonium salt	Inquiry
CAD-026	(Met(O)³⁵)-Amyloid β-Protein (1-42)	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Function of Cyclosporin A as an Immunosuppressant

Cyclosporin A (CsA) is a cyclic polypeptide consisting of 11 amino acids, which contains a new amino acid contai ...

Function of myristoyl hexapeptide-4 for improvement of skin

Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...

The effect of Sincalide on gastric movement

Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...

Methamphetamine and Substance P

Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...

β-secretase and γ-Secretase Inhibitors

Proteolytic Processing of APP Following discovery of the full-length APP cDNA clone, numerous studies were undertaken to dete ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: