CAT# | L12001 |
Sequence | FSKYERQKDKRPYSERKNQYTGPQFLYPPERIPPQKVIKWNEEGLPIYEIPGEGGHAEPAAA |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Figure 1. Chemical structure of pentagastrinPentagastrin, known as peptavlon, is a synthetic pentapeptide that p ...
What are oligopeptides? Oligopeptides, usually refer to short-chain polypeptides formed by the linkage of 2 to 20 amino acid ...
Palmitoyl Tripeptide-1 is also called Part of Matrixyl 3000. Palmitoyl Oligopeptide and Pal-GHK are believed to be able to st ...
Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...
What are collagen peptides? Collagen peptides are repair collagen, and the protein slowly decreases with age. It can be see ...