Keywords Search Google Search Search

Angiopep-2

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	PI-002
Chemical Name	(2S,5S,8S,14S,17S,20S,23S,26S,29S,35S,38S,47S,50S,53S,57R)-56-amino-20,23-bis(2-amino-2-oxoethyl)-14,29-bis(4-aminobutyl)-17,50,53-tribenzyl-5,8-bis(2-carboxyethyl)-26,35-bis(3-guanidinopropyl)-57-hydroxy-2,47-bis(4-hydroxybenzyl)-11-((R)-1-hydroxyethyl)-38-(hydroxymethyl)-4,7,10,13,16,19,22,25,28,31,34,37,40,43,46,49,52,55-octadecaoxo-3,6,9,12,15,18,21,24,27,30,33,36,39,42,45,48,51,54-octadecaazaoctapentacontanoic acid
M.F/Formula	C104H149N29O31
M.W/Mr.	2301.47
Sequence	TFFYGGSRGKRNNFKTEEY

CAT#	Product Name	Inquiry
R1758	Z-Gly-Gly-Arg-AMC	Inquiry
R1751	VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	Inquiry
R1209	Apamin	Inquiry
R2033	Pegylated synthetic human c-peptide	Inquiry
R0821	LPYFD-NH2	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Ornipressin: a synthetic derivative of vasopressin

Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...

Function of spadin in neurological treatment of depression

Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...

St-Ht31 P, an AKAP inhibitor

The peptide st-Ht31 P, A-kinase anchoring protein (AKAP) inhibitor, has the negative control for st-Ht31. In DRG ...

The effect of taltirelin in delayed neuronal death

Taltirelin is a thyrotropin-releasing hormone (TRH) analog that binds the brain BRH receptors in vivo. Taltireli ...

Function of Norleual in Pancreatic Cancer

Norleual is a potent inhibitor of the HGF/Met system, which inhibited the prosurvival effects of HGF and suppres ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: