CAT# | AF2848 |
Sequence | PLKKSLLLLFFFGTINLSLCQDETNPEEKKRDEEVAKMEE |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Octreotide, a long-acting structural derivative of somatostatins, is a synthetic peptide analog of somatostatin with the same ...
An of Dipeptide A Peptide is a constituent fragment in the structure of a protein and is linked by an amide bond ...
In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...
Teicoplanin is a glycopeptide antibiotic developed after vancomycin for the treatment of Gram-positive (G+) cocc ...
The history of the discovery and research of GLP-1 (Glucagon like peptide-1) can be traced back to the late 60s to early 70s ...