CAT# | AF2480 |
Sequence | CIKNGNGCQPNGSQNGCCSGYCHKQPGWVAGYCRRK |
Activity | Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Orexin A (OXA) and orexin B (OXB) are hypothalamic neuropeptides discovered in 1998, which bind to two G-protein ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...
What are oligopeptides? Oligopeptides, usually refer to short-chain polypeptides formed by the linkage of 2 to 20 amino acid ...
Background Aclerastide, one angiotensin receptor agonist, is the active ingredient of DSC127 and its general structure is sho ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...