Agitoxin-2 is an effective and selective blocker of the Shaker type voltage-gated Kv1.3 and Kv1.1 channels, which inhibits Kv1.1 with an IC50 value of around 140 pM and Kv1.3 with an IC50 value of around 200 pM.
CAT# | R0978 |
CAS | 168147-41-9 |
M.F/Formula | C169H278N54O48S8 |
M.W/Mr. | 4090.87 |
Sequence | GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bridge: Cys8 and Cys28,Cys14 and Cys33,Cys18 and Cys35) |
Labeling Target | Kv1.1 and Kv1.3 channels |
Appearance | White lyophilized solid |
Purity | >98% |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
GR 94800, is a linear heptapeptide with the structure of PhCO-Ala-Ala-D-Trp-Phe-D-Pro-Nle Amide, which is a high ...
Leuprolide acetate, an acetate salt with similar structure to luteinizing hormone-releasing hormone (LHRH) secre ...
The serine/threonine kinase Pim-1 plays an important role in cell cycle progression and apoptosis inhibition, re ...
The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...
The pancreatic polypeptide (PP) family includes three endogenous peptides: PP, peptides-neuropeptide Y (NYP) and ...