Agitoxin-2 is an effective and selective blocker of the Shaker type voltage-gated Kv1.3 and Kv1.1 channels, which inhibits Kv1.1 with an IC50 value of around 140 pM and Kv1.3 with an IC50 value of around 200 pM.
CAT# | R0978 |
CAS | 168147-41-9 |
M.F/Formula | C169H278N54O48S8 |
M.W/Mr. | 4090.87 |
Sequence | GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK (Disulfide bridge: Cys8 and Cys28,Cys14 and Cys33,Cys18 and Cys35) |
Labeling Target | Kv1.1 and Kv1.3 channels |
Appearance | White lyophilized solid |
Purity | >98% |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
What are collagen peptides? Collagen peptides are repair collagen, and the protein slowly decreases with age. It can be see ...
As a small actin-binding protein upregulated in highly metastatic prostate cancer cells, thymosin β15 (Tβ15) has ...
What are copper peptides? Copper peptides are tripeptide molecules composed of three amino acids that combine with copper io ...
Conantokin-T (Gly-Glu-Gla-Gla-Tyr-Gln-Lys-Met-Leu-Gla-Asn-Leu-Arg-Gla-Ala-Glu-Val-Lys-Asn-Ala-NH2), a 21-amino a ...
PT-141, also called as Bremelanotide, is a derivative for Melanotan 2 (M2). Unlike M2, PT-141 lacks C-terminal amide molecu ...