CAT# | AF3323 |
Sequence | IYWIADQFGIHLATGTARKLLDAVASGASLGTAFAAILGVTLPAWALAAAGALGATAA |
Activity | Gram+ & Gram-, |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Peptides are compounds formed by linking α-amino acids by peptide bonds, and are intermediate products of proteolysis. They a ...
What is palmitoyl hexapeptide-12? Lipopeptides, also known as acylpeptides, consist of a hydrophilic peptide bond and a lipo ...
Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...
The peptide Difopein, designed, isolated and identified by Haian Fu, is a high affinity inhibitor of 14-3-3 pro ...
10Panx is a panx 1 mimetic inhibitor that easily and reversibly inhibits panx1 currents. In cells that are diffi ...