CAT# | AF2381 |
Sequence | PPRPGQSKPFPSFPGHGPFNPKIQWPYPLPNPGH |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...
What is abaloparatide? Abaloparatide (formerly known as BA058) is an investigational analog of human PTHrP (1-34) being devel ...
Glucagon is a 29-amino acid peptide hormone that is synthesized in pancreatic α cells from the proglucagon precursor by proho ...
PR 39, a porcine 39-aa peptide antibiotic, was originally isolated from the upper part of the small intestine o ...
Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...