Prepro VIP (81-122), human
Prepro VIP (81-122), human
Prepro VIP (81-122), human is a prepro-vasoactive intestinal polypeptide (VIP) derived peptide, corresponding to residues 81-122. Peptide histidine valine 42 (PHV-42) has been designated to correspond exactly to Prepro VIP (81-122), which reduces both the force and frequency of spontaneous contractions of isolated rat uterus.
Online Inquiry
| CAT# | R1626 |
| CAS | 111366-38-2 |
| M.F/Formula | C₂₀₂H₃₂₅N₅₃O₆₄S |
| M.W/Mr. | 4552.13 |
| Sequence | One Letter Code: HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV
three Letter Code: His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Lys-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Met-Gly-Lys-Arg-Val-Ser-Ser-Asn-Ile-Ser-Glu-Asp-Pro-Val-Pro-Val |
Write a review
Ask a question
My Review for Prepro VIP (81-122), human
Required fields are marked with *
×
Ask a Question for Prepro VIP (81-122), human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
