Prepro VIP (81-122), human

Prepro VIP (81-122), human is a prepro-vasoactive intestinal polypeptide (VIP) derived peptide, corresponding to residues 81-122. Peptide histidine valine 42 (PHV-42) has been designated to correspond exactly to Prepro VIP (81-122), which reduces both the force and frequency of spontaneous contractions of isolated rat uterus.

Online Inquiry

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1626
CAS	111366-38-2
M.F/Formula	C₂₀₂H₃₂₅N₅₃O₆₄S
M.W/Mr.	4552.13
Sequence	One Letter Code: HADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPVPV three Letter Code: His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Lys-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Met-Gly-Lys-Arg-Val-Ser-Ser-Asn-Ile-Ser-Glu-Asp-Pro-Val-Pro-Val

CAT#	Product Name	Inquiry
R1865	GLP-2 (1-33) (human)	Inquiry
R1440	IGF-I (24-41) TFA	Inquiry
R2033	Pegylated synthetic human c-peptide	Inquiry
HB00030	Z-FA-FMK	Inquiry
R1369	Galanin (1-16), mouse, porcine, rat	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.