CAT# | L13005 |
Sequence | EKSCITWRNSCMHNDKGCCFPWSCVCWSQTVSRNSSGKEKKCQCRLW |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Purotoxin 1, a component from the venom of Geolycosa spiders, exerts selective inhibitory action on P2X3 recep ...
Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...
NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...
Myristoyl pentapeptide-8, a cosmetic peptide, is a synthetic peptide containing arginine, aspartic acid, glycine ...
Cyclotraxin B , a potent antagonist of TrkB receptors, inhibits BDNF-induced TrkB activity (IC50 = 0.30 nM). R ...