CAT# | L13005 |
Sequence | EKSCITWRNSCMHNDKGCCFPWSCVCWSQTVSRNSSGKEKKCQCRLW |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The voltage-gated Kv1.3 channel in effector memory T cells serves as a new therapeutic target for multiple scler ...
Octreotide, a long-acting structural derivative of somatostatins, is a synthetic peptide analog of somatostatin with the same ...
AdTx1, also called as ρ-Da1a, is a polypeptide of 65 amino acids stabilized by four disulfide bonds, which has a ...
Protirelin is also known as thyrotropin releasing hormone (TRH), a peptide hormone secreted by the hypothalamus. ...
Basic Fibroblast Growth Factor, Human, called basic fibroblast growth factor (bFGF/FGF-b/FGF-2), is a single cha ...