Huwentoxin-XVI, a 39 amino acids peptide, is potent and selective N-type Ca2+ channel blocker (IC50 ~ 60 nM). It can selectively and reversibly block N-type Ca2+ channels, but it does not block T-type Ca2+ channels, K+ channels or Na+ channels. It shows analgesic effects in vivo.
CAT# | R1055 |
CAS | 1600543-88-1 |
Background | HWTX-XVI, a 39-residue polypeptide with three disulfide bonds, was purified and characterized from Chinese tarantula venom. HWTX-XVI could block the twitch response of rat vas deferens to low-frequency electrical stimulation. HWTX-XVI selectively inhibited N-type calcium channels in DRG neurons but had no effect on other channels. >> Read More |
M.F/Formula | C196H292N50O56S6 |
M.W/Mr. | 4437.13 |
Sequence | CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK(Disulfide bridge: Cys1- and Cys6,Cys8 and Cys21,Cys15 and Cys36) |
Labeling Target | Calcium Channel |
Appearance | White lyophilised solid |
Purity | >98% |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Muramyl dipeptide (MDP) is the smallest structural unit with immune activity in the skeleton of bacille calmette ...
Tertiapin-Q (TPN-Q) is a small compact protein that contains twenty-one amino acids, which derived from bee veno ...
Lecirelin, a synthetic hormone, is a strongly basic nonapeptide with sequence yr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-A ...
Conotoxins are small peptides of 12 to 19 amino acids, which act as highly selective antagonists of ion channel ...
Timonacic's chemical name, L-Syrosin-4, is a new anti-tumor drug that converts cancer cells into normal cells. E ...