Huwentoxin-XVI, a 39 amino acids peptide, is potent and selective N-type Ca2+ channel blocker (IC50 ~ 60 nM). It can selectively and reversibly block N-type Ca2+ channels, but it does not block T-type Ca2+ channels, K+ channels or Na+ channels. It shows analgesic effects in vivo.
CAT# | R1055 |
CAS | 1600543-88-1 |
Background | HWTX-XVI, a 39-residue polypeptide with three disulfide bonds, was purified and characterized from Chinese tarantula venom. HWTX-XVI could block the twitch response of rat vas deferens to low-frequency electrical stimulation. HWTX-XVI selectively inhibited N-type calcium channels in DRG neurons but had no effect on other channels. >> Read More |
M.F/Formula | C196H292N50O56S6 |
M.W/Mr. | 4437.13 |
Sequence | CIGEGVPCDENDPRCCSGLVCLKPTLHGIWYKSYYCYKK(Disulfide bridge: Cys1- and Cys6,Cys8 and Cys21,Cys15 and Cys36) |
Labeling Target | Calcium Channel |
Appearance | White lyophilised solid |
Purity | >98% |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...
Afamelanotide, a drug for tanning skin, is a synthetic peptide and analogue of α-melanocyte stimulating hormone. ...
NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...
APC 366 [N-(1-hydroxy-2-naphthoyl)-L-arginyl-L-prolinamide], is a novel selective inhibitor of mast cell tryptas ...