CAT# | G09002 |
M.F/Formula | C149H246N44O42S |
M.W/Mr. | 3357.93 |
Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
L-ornithine α-ketoglutarate monohydrate, with some synonyms like OKG, OAKG and L-ornithine 2-oxoglutarate monohy ...
With the advancement of technology and the increasing demand for skin care, the variety of ingredients in the skin care marke ...
What are collagen peptides? Collagen peptides are repair collagen, and the protein slowly decreases with age. It can be see ...
Enfuvirtide, also named pentafuside, is an HIV fusion inhibitor originated at Duke University, where researchers ...
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...