Growth Hormone Releasing Factor, GRF (1 - 40), amide, human

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	G09005
M.W/Mr.	4543.1
Sequence	YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA-NH2

CAT#	Product Name	Inquiry
G09014	Growth Hormone (6-13), human	Inquiry
G09016	(D-Ala2)-GRF (1-29) amide (human)	Inquiry
G09015	(beta-Asp3)-GRF (human)	Inquiry
G09009	GRF (free acid) (human)	Inquiry
G09007	GRF, mouse	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of basic fibroblast growth factor in skin

Basic Fibroblast Growth Factor, Human, called basic fibroblast growth factor (bFGF/FGF-b/FGF-2), is a single cha ...

Ornipressin: a synthetic derivative of vasopressin

Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...

Palmitoyl tripeptide: A breakthrough ingredient in skin care science

With the advancement of technology and the increasing demand for skin care, the variety of ingredients in the skin care marke ...

Function of JIP1 in Promoting Axonal Growth

JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...

The efficacy of teicoplanin in the treatment of Gram-positive cocci infection

Teicoplanin is a glycopeptide antibiotic developed after vancomycin for the treatment of Gram-positive (G+) cocc ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: