PNC-27 is a peptide construct developed to prevent the interaction of human HDM-2/mouse MDM-2 and p53.
CAT# | OPO-001 |
CAS | 1159861-00-3 |
M.W/Mr. | 4029.2 |
Sequence | PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino aci ...
What is abaloparatide? Abaloparatide (formerly known as BA058) is an investigational analog of human PTHrP (1-34) being devel ...
Dulaglutide, sold under the brand name Trulicity, is a GLP-1 receptor agonist which is a class of medications th ...
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...
Afamelanotide, a drug for tanning skin, is a synthetic peptide and analogue of α-melanocyte stimulating hormone. ...