PeptideYY(3-36),human
Peptide YY (3-36) is a Y2 receptor antagonist. It reduces food intake and modulates brain activity in the appetite centers in humans.
Online Inquiry
| CAT# | R1849 |
| CAS | 123583-37-9 |
| Synonyms/Alias | PYY; Pancreatic Peptide YY; Peptide Tyrosine Tyrosine |
| M.F/Formula | C180H279N53O54 |
| M.W/Mr. | 4049.55 |
| Sequence | One Letter Code: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY (Modifications: Tyr-34 = C-terminal amide)
Three Letter Code: H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Purity | ≥95% |
| Storage | Desiccate at -20°C |
Solubility | Soluble in water (1 mg/ml), DMSO. |
Shipping Condition | Wet ice in continental US; may vary elsewhere |
InChI | InChI=1S/C180H279N53O54/c1-17-91(12)141(185)171(282)214-114(27-18-19-61-181)175(286)232-67-25-33-130(232)169(280)211-111(53-58-137(247)248)147(258)204-94(15)174(285)231-66-24-32-129(231)168(279)200-82-135(244)205-109(52-57-136(245)246)152(263)226-126 |
InChI Key | AUHJXHCVECGTKR-RIBGVNDISA-N |
Write a review
Ask a question
My Review for PeptideYY(3-36),human
Required fields are marked with *
×
Ask a Question for PeptideYY(3-36),human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
