Peptide Inhibitors

Online Inquiry
Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
CAT# Product Name M.W Molecular Formula Inquiry
R1399 GRGDSP TFA 701.61 C₂₄H₃₈F₃N₉O₁₂ Inquiry
R1400 GRGDSPC 690.7 C25H42N10O11S Inquiry
R1401 GRGDSPK 715.8 C28H49N11O11 Inquiry
R1402 GroES mobile loop 1219.40 C₅₁H₉₀N₁₄O₂₀ Inquiry
R1403 GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 3850.31 Inquiry
R1405 HAE 355.35 C₁₄H₂₁N₅O₆ Inquiry
R1406 HAEGT 513.5 C20H31N7O9 Inquiry
R1407 HAEGTFT 761.8 C33H47N9O12 Inquiry
R1408 HAEGTFTSD 963.9 C40H57N11O17 Inquiry
R1409 HAEGTFTSDVS 1150.2 C48H71N13O20 Inquiry
R1410 HAEGTFTSDVSSYLE 1642.71 C₇₁H₁₀₃N₁₇O₂₈ Inquiry
R1411 Handle region peptide, rat 1244.6 C56H105N15O14S Inquiry
R1413 Hemokinin 1 mouse 1413.65 C₆₁H₁₀₀N₂₂O₁₅S Inquiry
R1414 Hemorphin-7 997.11 C₄₉H₆₄N₁₂O₁₁ Inquiry
R1415 Hepatitis B Virus Core 128-140 1406.6 C66H103N17O17 Inquiry
R1416 HER2/neu (654-662) GP2 884.1 C42H77N9O11 Inquiry
R1417 HEX3 2182.7 C142H152N6O15 Inquiry
R1418 Hexa-His 840.9 C36H44N18O7 Inquiry
R1419 H-Gly-Gly-Pro-OH 229.23 C₉H₁₅N₃O₄ Inquiry
R1420 H-Gly-Pro-OH 172.18 C7H12N2O3 Inquiry
Quick Inquiry
×
Get in touch with us

Copyright © 2025 Creative Peptides. All rights reserved.

We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy

Accept Cookies
x