Search
GMP peptide
Peptides CDMO
Capabilities
Applications for Custom peptides

Peptide Inhibitors

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Online Inquiry

CAT# Product Name M.W Molecular Formula Inquiry
R1387 Gluten Exorphin B5 594.66 C₃₀H₃₈N₆O₇ Inquiry
R1388 Gluten Exorphin C 591.70 C₂₉H₄₅N₅O₈ Inquiry
R1389 Gly6 360.32 C₁₂H₂₀N₆O₇ Inquiry
R1391 Glycoprotein 276-286 1095.18 C₄₆H₇₀N₁₂O₁₇S Inquiry
R1392 Gly-Phe-Arg 378.43 C₁₇H₂₆N₆O₄ Inquiry
R1393 GnRH-I 1182.32 C₅₀H₇₅N₁₇O₁₃ Inquiry
R1394 GP(33-41) 1016.18 C₄₆H₆₉N₁₁O₁₃S Inquiry
R1396 Gp100 619-627 1123.33 C₄₉H₈₂N₁₄O₁₄S Inquiry
R1397 GPRP acetate 485.53 C₂₀H₃₅N₇O₇ Inquiry
R1398 GRGDSP 587.58 C₂₂H₃₇N₉O₁₀ Inquiry
R1399 GRGDSP TFA 701.61 C₂₄H₃₈F₃N₉O₁₂ Inquiry
R1400 GRGDSPC 690.73 C₂₅H₄₂N₁₀O₁₁S Inquiry
R1401 GRGDSPK 715.76 C₂₈H₄₉N₁₁O₁₁ Inquiry
R1402 GroES mobile loop 1219.40 C₅₁H₉₀N₁₄O₂₀ Inquiry
R1403 GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 3850.31 Inquiry
R1405 HAE 355.35 C₁₄H₂₁N₅O₆ Inquiry
R1406 HAEGT 513.50 C₂₀H₃₁N₇O₉ Inquiry
R1407 HAEGTFT 761.78 C₃₃H₄₇N₉O₁₂ Inquiry
R1408 HAEGTFTSD 963.94 C₄₀H₅₇N₁₁O₁₇ Inquiry
R1409 HAEGTFTSDVS 1150.18 C₄₈H₇₁N₁₃O₂₀ Inquiry
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Customer Support & Price Inquiry
Recommended Services

OligoPeptide Synthesis

Custom Conjugation Service

Peptide PEGylation

Epitope Mapping Services

Protein Glycosylation

Peptide Characterization

Peptide Profiling

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Novel Peptide Drugs Treat Multiple Diseases (Part One)

Peptides are the ideal drug molecules because of their high affinity, high selectivity, low toxicity, and easy synthesis. Sci ...

Inhibitors of Aspartic Proteases-Acetyl Pepstatin

 Acetyl pepstatin, nature products of yeast fermentation, is general inhibitors of the family of aspartic proteas ...

Function of porcine secretin on cannulation of the dorsal pancreatic duct at ERCP in patients with pancreas divisum

  Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...

Introduction of Pentapeptide-3

Factors of natural aging  Natural aging of the skin results in decreased production and increased degradation of extracellula ...

Function of a vasoactive peptide Endothelin-1

 Endothelin-1 (ET-1) is a vasoactive peptide containing 21 amino acids, which was first isolated from the culture ...

Quick Inquiry
×
Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Copyright © 2024 Creative Peptides. All rights reserved.