* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
R1362 | Fmoc-Thr[GalNAc(Ac)3-α-D]-OH | 670.66 | C₃₃H₃₈N₂O₁₃ | Inquiry |
R1363 | Fmoc-Val-Cit-PAB-PNP | 766.80 | C₄₀H₄₂N₆O₁₀ | Inquiry |
R1364 | FMRF | 599.74 | C₂₉H₄₁N₇O₅S | Inquiry |
R1365 | FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | 3692.15 | Inquiry | |
R1366 | Fz7-21 | 1796.05 | C83H114N18O23S2 | Inquiry |
R1367 | G280-9 | 946.05 | C₄₄H₆₇N₉O₁₄ | Inquiry |
R1368 | G3-C12 TFA | 1873.00 | C₇₄H₁₁₅N₂₃O₂₃S₂.C₂HF₃O₂ | Inquiry |
R1369 | Galanin (1-16), mouse, porcine, rat | 1669.88 | C₇₈H₁₁₆N₂₀O₂₁ | Inquiry |
R1370 | Galanin (1-16), mouse, porcine, rat TFA | 1783.90 | C₈₀H₁₁₇F₃N₂₀O₂₃ | Inquiry |
R1371 | Galanin (1-19), human | 1964.14 | C₈₉H₁₃₀N₂₆O₂₅ | Inquiry |
R1373 | Galanin Receptor Ligand M35 | 2233.6 | C₁₀₇H₁₅₃N₂₇O₂₆ | Inquiry |
R1374 | Gap 26 | 1550.78 | C70H107N19O19S | Inquiry |
R1375 | Gap 27 | 1304.53 | C60H101N15O17 | Inquiry |
R1376 | Gastric mucin | Inquiry | ||
R1377 | Gastrin I (1-14), human | 1705.73 | C₇₉H₁₀₀N₁₆O₂₇ | Inquiry |
R1379 | GLGPNPCRKKCYKRDFLGR | 2208.64 | C₉₆H₁₅₈N₃₂O₂₄S₂ | Inquiry |
R1380 | GLP-1 moiety from Dulaglutide | 3314.62 | C₁₄₉H₂₂₁N₃₇O₄₉ | Inquiry |
R1382 | GLP-1(7-37) | 3355.67 | C151H228N40O47 | Inquiry |
R1385 | Glucagon-Like Peptide (GLP) II, human | 3766.20 | C₁₆₅H₂₅₄N₄₄O₅₅S | Inquiry |
R1386 | Glucagon-like peptide 1 (1-37), human | 4169.48 | C₁₈₆H₂₇₅N₅₁O₅₉ | Inquiry |
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
TC 14012 is a serum-stable derivative of the peptidomimetic T140, which is a cyclic peptide with the structure o ...
Peptides are compounds formed by linking α-amino acids by peptide bonds, and are intermediate products of proteolysis. They a ...
Zonisamide, sold as brand name Zonegran, is a derivative of 3-(sulfamoylmethyl)-l,2-benzisoxazole. It is a membe ...
Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...
Purotoxin 1, a component from the venom of Geolycosa spiders, exerts selective inhibitory action on P2X3 recep ...