Peptide Inhibitors

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Online Inquiry

CAT# Product Name M.W Molecular Formula Inquiry
R1362 Fmoc-Thr[GalNAc(Ac)3-α-D]-OH 670.66 C₃₃H₃₈N₂O₁₃ Inquiry
R1363 Fmoc-Val-Cit-PAB-PNP 766.80 C₄₀H₄₂N₆O₁₀ Inquiry
R1364 FMRF 599.74 C₂₉H₄₁N₇O₅S Inquiry
R1365 FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 3692.15 Inquiry
R1366 Fz7-21 1796.05 C83H114N18O23S2 Inquiry
R1367 G280-9 946.05 C₄₄H₆₇N₉O₁₄ Inquiry
R1368 G3-C12 TFA 1873.00 C₇₄H₁₁₅N₂₃O₂₃S₂.C₂HF₃O₂ Inquiry
R1369 Galanin (1-16), mouse, porcine, rat 1669.88 C₇₈H₁₁₆N₂₀O₂₁ Inquiry
R1370 Galanin (1-16), mouse, porcine, rat TFA 1783.90 C₈₀H₁₁₇F₃N₂₀O₂₃ Inquiry
R1371 Galanin (1-19), human 1964.14 C₈₉H₁₃₀N₂₆O₂₅ Inquiry
R1373 Galanin Receptor Ligand M35 2233.6 C₁₀₇H₁₅₃N₂₇O₂₆ Inquiry
R1374 Gap 26 1550.78 C70H107N19O19S Inquiry
R1375 Gap 27 1304.53 C60H101N15O17 Inquiry
R1376 Gastric mucin Inquiry
R1377 Gastrin I (1-14), human 1705.73 C₇₉H₁₀₀N₁₆O₂₇ Inquiry
R1379 GLGPNPCRKKCYKRDFLGR 2208.64 C₉₆H₁₅₈N₃₂O₂₄S₂ Inquiry
R1380 GLP-1 moiety from Dulaglutide 3314.62 C₁₄₉H₂₂₁N₃₇O₄₉ Inquiry
R1382 GLP-1(7-37) 3355.67 C151H228N40O47 Inquiry
R1385 Glucagon-Like Peptide (GLP) II, human 3766.20 C₁₆₅H₂₅₄N₄₄O₅₅S Inquiry
R1386 Glucagon-like peptide 1 (1-37), human 4169.48 C₁₈₆H₂₇₅N₅₁O₅₉ Inquiry
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Customer Support & Price Inquiry

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

 TC 14012 is a serum-stable derivative of the peptidomimetic T140, which is a cyclic peptide with the structure o ...

Peptides are compounds formed by linking α-amino acids by peptide bonds, and are intermediate products of proteolysis. They a ...

 Zonisamide, sold as brand name Zonegran, is a derivative of 3-(sulfamoylmethyl)-l,2-benzisoxazole. It is a membe ...

Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...

  Purotoxin 1, a component from the venom of Geolycosa spiders, exerts selective inhibitory action on P2X3 recep ...

Quick Inquiry
×
Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Copyright © 2024 Creative Peptides. All rights reserved.