CAT# | R0931 |
CAS | 212609-11-5 |
M.F/Formula | C149H238N42O53S3 |
M.W/Mr. | 3561.93 |
Sequence | MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Urantide is a UⅡ receptor antagonist. It can effectively alleviate monocrotaline (MCT)-induced PAH in a rat mode ...
Peptide YY is referred to as PYY. Its structure is highly homologous with pancreatic polypeptide (PP) and neurop ...
Perindopril erbumine is an angiotensioncon vertingenzyme (ACE) inhibitor without sulfhydryl group. It is a chi ...
The history of the discovery and research of GLP-1 (Glucagon like peptide-1) can be traced back to the late 60s to early 70s ...
Foreword We live in a photoshopped world, where we are constantly updated by images of digital perfection. It's easy to becom ...