Human growth hormone-releasing factor
Human growth hormone-releasing factor
Human growth hormone-releasing factor stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary.
Online Inquiry
| CAT# | R1435 |
| CAS | 83930-13-6 |
| Synonyms/Alias | Growth Hormone Releasing Factor human |
| M.F/Formula | C₂₁₅H₃₅₈N₇₂O₆₆S |
| M.W/Mr. | 5039.65 |
| Sequence | One Letter Code: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
three Letter Code: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 |
Write a review
Ask a question
My Review for Human growth hormone-releasing factor
Required fields are marked with *
×
Ask a Question for Human growth hormone-releasing factor
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
