CAT# | AF2169 |
Sequence | WKSESVCTPGCVTGLLQTCFLQTITCNCKISK |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino aci ...
An of Dipeptide A Peptide is a constituent fragment in the structure of a protein and is linked by an amide bond ...
Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...
NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...
The serine/threonine kinase Pim-1 plays an important role in cell cycle progression and apoptosis inhibition, re ...