We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy
β-Endorphin is an endogenous opioid peptide that acts as an agonist at μ-opioid receptors (μORs) and exhibits immunomodulatory, neuromodulatory, antidepressant, and antinociceptive/analgesic activities. In vivo, β-endorphin increases levels of B-cells and production of antibodies as well as secretion of IL-4 and proliferation of splenocytes, shifting the immune response toward Th2-specific mediators.
CAT No: R1885
CAS No: 77367-63-6
Synonyms/Alias: β-Lipotropin (61-91), rat; Proopiomelanocortin; POMC.
Quick InquiryCustom Peptide SynthesisPeptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C157H254N42O44S |
M.W/Mr. | 3466.02 |
Sequence | One Letter Code: YGGFMTSEKSQTPLVTLFKNAIIKNVHKKGQ Three Letter Code: Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Val-His-Lys-Lys-Gly-Gln |
Appearance | Whithe powder |
Purity | ≥97% (HPLC) |
Long-term Storage Conditions | Soluble in water. |
Shipping Condition | RT, or blue ice upon request. |
2. Emu oil in combination with other active ingredients for treating skin imperfections
5. Cationic cell-penetrating peptides are potent furin inhibitors
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
USA
Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA
Tel: 1-631-624-4882
Fax: 1-631-614-7828
Email: info@creative-peptides.com
Germany
Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main
Email: info@creative-peptides.com