We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy
Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
CAT No: R1263
CAS No: 47931-85-1
Synonyms/Alias: Salmon calcitonin
Quick InquiryCustom Peptide SynthesisPeptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C₁₄₅H₂₄₀N₄₄O₄₈S₂ |
M.W/Mr. | 3431.85 |
Sequence | One Letter Code: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: Cys1-Cys7) three Letter Code: Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7) |
Biological Activity | Stimulates bone formation by osteoblasts and inhibits bone resorption. |
Long-term Storage Conditions | Soluble to 1 mg/ml in water |
Shipping Condition | Room temperature in continental US; may vary elsewhere. |
1. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
2. The spatiotemporal control of signalling and trafficking of the GLP-1R
3. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
USA
Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA
Tel: 1-631-624-4882
Fax: 1-631-614-7828
Email: info@creative-peptides.com
Germany
Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main
Email: info@creative-peptides.com