Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) is a melanocortin receptor agonist.
CAT# | R1164 |
Synonyms/Alias | 1-39-Corticotropin (human)(TFA) |
M.F/Formula | C₂₀₇H₃₀₈N₅₆O₅₈S.C₂HF₃O₂ |
M.W/Mr. | 4655.16 |
Sequence | One Letter Code: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF three Letter Code: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Gonadorelin acetate, a synthetic decapeptide with sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2, is a gon ...
Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...
Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...
Sinapultide (also known as KL4 peptide) is a synthetic protein used to mimic human SP-B. Respiratory distress ...
Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...