Adrenocorticotropic Hormone (ACTH) (1-39), human(TFA) is a melanocortin receptor agonist.
CAT# | R1164 |
Synonyms/Alias | 1-39-Corticotropin (human)(TFA) |
M.F/Formula | C₂₀₇H₃₀₈N₅₆O₅₈S.C₂HF₃O₂ |
M.W/Mr. | 4655.16 |
Sequence | One Letter Code: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF three Letter Code: Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
In the respiratory tract, there are tachykinin P (SP) and neurokinin A (NKA) in capsaicin-sensitive primary affe ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
Urantide is a UⅡ receptor antagonist. It can effectively alleviate monocrotaline (MCT)-induced PAH in a rat mode ...
Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...
Muramyl dipeptide (MDP) is the smallest structural unit with immune activity in the skeleton of bacille calmette ...