ProTx I is potent, selective CaV3.1 channel blocker. It also reversibly inhibits NaV1.8 and KV2.1 channels.
CAT# | R0936 |
CAS | 484598-35-8 |
M.F/Formula | C171H245N53O47S6 |
M.W/Mr. | 3987.51 |
Sequence | ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS(Disulfide bridge: Cys2 and Cys16, Cys9 and Cys21, Cys15 and Cys28) |
Labeling Target | CaV3.1 channel |
Appearance | White lyophilised solid |
Purity | >98% |
Activity | Inhibitor |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
Topotecan (TPT) is a water-soluble, semi-synthetic camptothecin derivative developed by Smithkline Beecham, USA. ...
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
Today, many attempts have been made to reduce or stop the aging effect on the skin. As the skin ages, wrinkles, lines, brown ...
Basic information Desmopressin is a synthetic analogue of the antidiuretic hormone vasopressin used in the treatment of centr ...