ProTx I is potent, selective CaV3.1 channel blocker. It also reversibly inhibits NaV1.8 and KV2.1 channels.
CAT# | R0936 |
CAS | 484598-35-8 |
M.F/Formula | C171H245N53O47S6 |
M.W/Mr. | 3987.51 |
Sequence | ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS(Disulfide bridge: Cys2 and Cys16, Cys9 and Cys21, Cys15 and Cys28) |
Labeling Target | CaV3.1 channel |
Appearance | White lyophilised solid |
Purity | >98% |
Activity | Inhibitor |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
KAI-1678, a synthetic 21-amino acid, is a novel PKC-epsilon (ε-PKC) inhibitor with a molecular weight of 2541 Da ...
Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...
Corticotropin-releasing factor (CRF) is a 41 amino acid peptide that is an important hormone in the hypothalamic ...
Obestatin is a 23-amino acid peptide hormone produced in specific epithelial cells of the stomach and small inte ...
Jingzhaotoxin-III (β-TRTX-Cj1α) is a kind of sodium channel gating modifier which is from the tarantula Chilobra ...