Search
GMP peptide
Peptides CDMO
Capabilities
Applications for Custom peptides

Peptide Inhibitors

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Online Inquiry

CAT# Product Name M.W Molecular Formula Inquiry
R1653 RC-3095 1106.32 C₅₆H₇₉N₁₅O₉ Inquiry
R1654 ReACp53 2617.13 C₁₀₈H₂₀₆N₅₂O₂₄ Inquiry
R1656 RGD peptide (GRGDNP) TFA 728.63 C₂₅H₃₉F₃N₁₀O₁₂ Inquiry
R1657 RGD peptide GRGDNP 614.61 C23H38N10O10 Inquiry
R1658 RGD Trifluoroacetate 460.36 C₁₄H₂₃F₃N₆O₈ Inquiry
R1659 rGHRH(1-29)NH2 3473.02 C₁₅₅H₂₅₁N₄₉O₄₀S Inquiry
R1660 Rhodopsin Epitope Tag 902.95 C₃₇H₆₂N₁₀O₁₆ Inquiry
R1661 RNAIII-inhibiting peptide(TFA) 1027.01 C₄₇H₅₇F₃N₁₀O₁₃ Inquiry
R1662 Rusalatide acetate 2371.50 C₉₉H₁₅₁N₂₉O₃₇S Inquiry
R1663 S Tag Peptide 1748.91 C₇₃H₁₁₇N₂₃O₂₅S Inquiry
R1664 Sakamototide substrate peptide TFA 1853.92 C₇₁H₁₂₃F₃N₃₀O₂₅ Inquiry
R1665 SAMS 1779.15 C₇₄H₁₃₁N₂₉O₁₈S₂ Inquiry
R1666 Scyliorhinin II 1851.09 C₇₇H₁₁₉N₂₁O₂₆S₃ Inquiry
R1667 SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 3443.87 Inquiry
R1668 SEB Domain 144-153 1159.33 C₅₀H₉₀N₁₄O₁₇ Inquiry
R1669 Secretin (28-54), human 3039.46 C₁₃₀H₂₂₀N₄₄O₄₀ Inquiry
R1670 Secretin (33-59), rat 3027.35 C₁₂₉H₂₁₆N₄₂O₄₂ Inquiry
R1671 Secretin, canine 3069.43 C₁₃₁H₂₂₂N₄₄O₄₁ Inquiry
R1672 Secretin, porcine 3055.45 C₁₃₀H₂₂₀N₄₄O₄₁. xC₂H₄O₂ Inquiry
R1673 Secretoneurin, rat 3651.95 C₁₅₉H₂₅₂N₄₀O₅₈ Inquiry
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Customer Support & Price Inquiry
Recommended Services

OligoPeptide Synthesis

Custom Conjugation Service

Peptide PEGylation

Epitope Mapping Services

Protein Glycosylation

Peptide Characterization

Peptide Profiling

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of lepirudin in heparin-induced thrombocytopenia

 Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...

Function of phosphoramidon as an endothelin converting enzyme inhibitor

 Phosphoramidon is a kind of thermolysin inhibitor isolated from a culture filtrate of streptomyces. It has prove ...

Function of myristoyl hexapeptide-4 for improvement of skin

 Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...

Enhanced Binding and Antagonism of Camstatin

  Camstatin is a similar PEP-19 analogue with enhanced calmodulin binding and antagonism. It is a functional 25- ...

Copper peptides: classification, benefits, and mechanism of action

What are copper peptides? Copper peptides are tripeptide molecules composed of three amino acids that combine with copper io ...

Quick Inquiry
×
Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Copyright © 2024 Creative Peptides. All rights reserved.