Search
GMP peptide
Peptides CDMO
Capabilities
Applications for Custom peptides

Peptide Inhibitors

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Online Inquiry

CAT# Product Name M.W Molecular Formula Inquiry
R1653 RC-3095 1106.32 C₅₆H₇₉N₁₅O₉ Inquiry
R1654 ReACp53 2617.13 C₁₀₈H₂₀₆N₅₂O₂₄ Inquiry
R1656 RGD peptide (GRGDNP) TFA 728.63 C₂₅H₃₉F₃N₁₀O₁₂ Inquiry
R1657 RGD peptide GRGDNP 614.61 C23H38N10O10 Inquiry
R1658 RGD Trifluoroacetate 460.36 C₁₄H₂₃F₃N₆O₈ Inquiry
R1659 rGHRH(1-29)NH2 3473.02 C₁₅₅H₂₅₁N₄₉O₄₀S Inquiry
R1660 Rhodopsin Epitope Tag 902.95 C₃₇H₆₂N₁₀O₁₆ Inquiry
R1661 RNAIII-inhibiting peptide(TFA) 1027.01 C₄₇H₅₇F₃N₁₀O₁₃ Inquiry
R1662 Rusalatide acetate 2371.50 C₉₉H₁₅₁N₂₉O₃₇S Inquiry
R1663 S Tag Peptide 1748.91 C₇₃H₁₁₇N₂₃O₂₅S Inquiry
R1664 Sakamototide substrate peptide TFA 1853.92 C₇₁H₁₂₃F₃N₃₀O₂₅ Inquiry
R1665 SAMS 1779.15 C₇₄H₁₃₁N₂₉O₁₈S₂ Inquiry
R1666 Scyliorhinin II 1851.09 C₇₇H₁₁₉N₂₁O₂₆S₃ Inquiry
R1667 SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 3443.87 Inquiry
R1668 SEB Domain 144-153 1159.33 C₅₀H₉₀N₁₄O₁₇ Inquiry
R1669 Secretin (28-54), human 3039.46 C₁₃₀H₂₂₀N₄₄O₄₀ Inquiry
R1670 Secretin (33-59), rat 3027.35 C₁₂₉H₂₁₆N₄₂O₄₂ Inquiry
R1671 Secretin, canine 3069.43 C₁₃₁H₂₂₂N₄₄O₄₁ Inquiry
R1672 Secretin, porcine 3055.45 C₁₃₀H₂₂₀N₄₄O₄₁. xC₂H₄O₂ Inquiry
R1673 Secretoneurin, rat 3651.95 C₁₅₉H₂₅₂N₄₀O₅₈ Inquiry
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Customer Support & Price Inquiry
Recommended Services

OligoPeptide Synthesis

Custom Conjugation Service

Peptide PEGylation

Epitope Mapping Services

Protein Glycosylation

Peptide Characterization

Peptide Profiling

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The effect of taltirelin in delayed neuronal death

 Taltirelin is a thyrotropin-releasing hormone (TRH) analog that binds the brain BRH receptors in vivo. Taltireli ...

Function of DAMME in analgesia

  DAMME (DA) is a guanine, often referred to as FK 33-824 (FK), which is a long-acting enkephalin analog. Natur ...

Function of Huwentoxin-XVI in analgesia

 Ornithoctonus huwena, Chinese tarantula, is one of the most venomous spiders in China, and its venom can kill in ...

Function of propofol in anaesthesia

 Propofol, known as 2,6-Diisopropyl phenol, is mainly used in the induction and maintenance of general anesthesia ...

BA 1, a potent BRS-3 agonist

 BA 1 (DTyr-Gln-Trp-Ala-Val- Ala-His-Phe-Nle-NH2) is a potent BRS-3 agonist (IC50 = 2.52 nM) and a NMBR and GRPR ...

Quick Inquiry
×
Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Copyright © 2024 Creative Peptides. All rights reserved.