Secretoneurin, rat
Secretoneurin, rat, a 33-amino acid polypeptide, is generated by proteolytic processing of secretogranin II (SgII). Secretoneurin, rat induces dopamine release in the rat striatum in vivo and in vitro, and it exerts a very strong chemotactic effect on monocytes and eosinophils but not on granulocytes.
Online Inquiry
| CAT# | R1673 |
| CAS | 149146-12-3 |
| M.F/Formula | C₁₅₉H₂₅₂N₄₀O₅₈ |
| M.W/Mr. | 3651.95 |
| Sequence | One Letter Code: TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
three Letter Code: Thr-Asn-Glu-Ile-Val-Glu-Glu-Gln-Tyr-Thr-Pro-Gln-Ser-Leu-Ala-Thr-Leu-Glu-Ser-Val-Phe-Gln-Glu-Leu-Gly-Lys-Leu-Thr-Gly-Pro-Ser-Asn-Gln |
| Source# | Synthetic |
Storage | -20 ± 5 °C |
Write a review
Ask a question
My Review for Secretoneurin, rat
Required fields are marked with *
×
Ask a Question for Secretoneurin, rat
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
