* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
R1742 | Urotensin I | 4869.46 | C₂₁₀H₃₄₀N₆₂O₆₇S₂ | Inquiry |
R1743 | Urotensin II (114-124), human | 1388.57 | C₆₄H₈₅N₁₃O₁₈S₂ | Inquiry |
R1744 | Urotensin II (114-124), human TFA | 1502.59 | C₆₆H₈₆F₃N₁₃O₂₀S₂ | Inquiry |
R1745 | Urotensin II, mouse | 1633.86 | C76H100N18O19S2 | Inquiry |
R1746 | Uty HY Peptide 246-254 | 1196.40 | C₅₃H₇₇N₁₅O₁₃S₂ | Inquiry |
R1747 | V5 Epitope Tag Peptide Trifluoroacetate | 1535.66 | C₆₄H₁₀₈N₁₆O₂₀.C₂HF₃O₂ | Inquiry |
R1748 | Vasonatrin Peptide VNP | 2865.37 | C₁₂₃H₁₉₈N₃₆O₃₆S₃ | Inquiry |
R1749 | VIP(6-28)(human, rat, porcine, bovine) | 2816.28 | C₁₂₆H₂₀₇N₃₇O₃₄S | Inquiry |
R1750 | VIR-165 | 2240.70 | C₁₀₉H₁₅₈N₂₂O₂₅S₂ | Inquiry |
R1751 | VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | 3241.70 | Inquiry | |
R1752 | VSV-G Peptide | 1339.52 | C₅₇H₉₄N₁₆O₁₉S | Inquiry |
R1753 | WKYMVM | 856.11 | C₄₁H₆₁N₉O₇S₂ | Inquiry |
R1754 | Xenin | 2971.57 | C₁₃₉H₂₂₄N₃₈O₃₂S | Inquiry |
R1755 | Xenopsin | 980.16 | C₄₇H₇₃N₁₃O₁₀ | Inquiry |
R1756 | X-press Tag Peptide | 997.96 | C₄₁H₅₉N₉O₂₀ | Inquiry |
R1757 | YRGDS Fibronectin Fragment | 596.59 | C₂₄H₃₆N₈O₁₀ | Inquiry |
R1758 | Z-Gly-Gly-Arg-AMC | 579.60 | C₂₈H₃₃N₇O₇ | Inquiry |
R1759 | Z-Gly-Gly-Arg-AMC acetate | 639.66 | C₃₀H₃₇N₇O₉ | Inquiry |
R1760 | α2β1 Integrin Ligand Peptide | 390.35 | C₁₄H₂₂N₄O₉ | Inquiry |
R1761 | α-Casein 90-95 | 783.91 | C₃₈H₅₇N₉O₉ | Inquiry |
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Phosphoramidon is a kind of thermolysin inhibitor isolated from a culture filtrate of streptomyces. It has prove ...
Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino aci ...
Anisomycin, also known by its trade name flagecidin, is a bacterial pyrrolidine antibiotic mostly isolated from ...
Corticotropin-releasing factor (CRF) is a 41 amino acid peptide that is an important hormone in the hypothalamic ...
Thymosin Thymosin is a hormone secreted from the thymus. This is the reason why it is named Thymosin. But most are now known ...