Search
GMP peptide
Peptides CDMO
Capabilities
Applications for Custom peptides

Peptide Inhibitors

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Online Inquiry

CAT# Product Name M.W Molecular Formula Inquiry
R1742 Urotensin I 4869.46 C₂₁₀H₃₄₀N₆₂O₆₇S₂ Inquiry
R1743 Urotensin II (114-124), human 1388.57 C₆₄H₈₅N₁₃O₁₈S₂ Inquiry
R1744 Urotensin II (114-124), human TFA 1502.59 C₆₆H₈₆F₃N₁₃O₂₀S₂ Inquiry
R1745 Urotensin II, mouse 1633.86 C76H100N18O19S2 Inquiry
R1746 Uty HY Peptide 246-254 1196.40 C₅₃H₇₇N₁₅O₁₃S₂ Inquiry
R1747 V5 Epitope Tag Peptide Trifluoroacetate 1535.66 C₆₄H₁₀₈N₁₆O₂₀.C₂HF₃O₂ Inquiry
R1748 Vasonatrin Peptide VNP 2865.37 C₁₂₃H₁₉₈N₃₆O₃₆S₃ Inquiry
R1749 VIP(6-28)(human, rat, porcine, bovine) 2816.28 C₁₂₆H₂₀₇N₃₇O₃₄S Inquiry
R1750 VIR-165 2240.70 C₁₀₉H₁₅₈N₂₂O₂₅S₂ Inquiry
R1751 VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 3241.70 Inquiry
R1752 VSV-G Peptide 1339.52 C₅₇H₉₄N₁₆O₁₉S Inquiry
R1753 WKYMVM 856.11 C₄₁H₆₁N₉O₇S₂ Inquiry
R1754 Xenin 2971.57 C₁₃₉H₂₂₄N₃₈O₃₂S Inquiry
R1755 Xenopsin 980.16 C₄₇H₇₃N₁₃O₁₀ Inquiry
R1756 X-press Tag Peptide 997.96 C₄₁H₅₉N₉O₂₀ Inquiry
R1757 YRGDS Fibronectin Fragment 596.59 C₂₄H₃₆N₈O₁₀ Inquiry
R1758 Z-Gly-Gly-Arg-AMC 579.60 C₂₈H₃₃N₇O₇ Inquiry
R1759 Z-Gly-Gly-Arg-AMC acetate 639.66 C₃₀H₃₇N₇O₉ Inquiry
R1760 α2β1 Integrin Ligand Peptide 390.35 C₁₄H₂₂N₄O₉ Inquiry
R1761 α-Casein 90-95 783.91 C₃₈H₅₇N₉O₉ Inquiry
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Customer Support & Price Inquiry
Recommended Services

OligoPeptide Synthesis

Custom Conjugation Service

Peptide PEGylation

Epitope Mapping Services

Protein Glycosylation

Peptide Characterization

Peptide Profiling

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of Mifamurtide in Osteosarcoma

 The immunomodulator mifamurtide (liposomal muramyltripeptide phosphatidyl ethanolamine [L-MTP-PE]) is a syntheti ...

Function of linaclotide in irritable bowel syndrome

 Linaclotide, sold under the brand name Linzess, is a synthetic tetradecapeptide and guanylate cyclase (GC-C) rec ...

Function of romurtide in anti-leukocyte

 Muramyl dipeptide (MDP) is the smallest structural unit with immune activity in the skeleton of bacille calmette ...

GIP (gastric inhibitory polypeptide or glucosedependent insulinotropic peptide)

GIP is a 42-aminoacid peptide secreted from the intestinal K-cells (located mainly in the duodenum and proximal jejunum) and ...

MC1R antagonist-MSG 606

 MSG 606 (Cyclo-[(CH2) 3CO-Gly-His-D-Phe-Arg-D-Trp-Cys(S-)]-Asp-Arg-Phe-Gly-NH2) is a potent and novel cyclic thi ...

Quick Inquiry
×
Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Copyright © 2024 Creative Peptides. All rights reserved.