Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | HSSGYTRPLRKPSRPIFIRPIGCDVCYGIPSSTARLCCFRYGDCCHL |
Activity | Gram+, Fungi, |
Host Chemicals | Atlantic Litopenaeus setiferus |
Length | 47 |
SwissProt ID | PDB ID: 1XV3 |
3. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.