CAT# | AF3089 |
Sequence | GKVWDWIKSAAKKIWSSEPVSQLKGQVLNAAKNYVAEKIGATPT |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Sinapultide (also known as KL4 peptide) is a synthetic protein used to mimic human SP-B. Respiratory distress ...
MSG 606 (Cyclo-[(CH2) 3CO-Gly-His-D-Phe-Arg-D-Trp-Cys(S-)]-Asp-Arg-Phe-Gly-NH2) is a potent and novel cyclic thi ...
Peginesatide sold under the brand name Omontys, formerly Hematide, is a synthetic peptide consisting of two 21 a ...
Octreotide, a long-acting structural derivative of somatostatins, is a synthetic peptide analog of somatostatin with the same ...
Urantide is a UⅡ receptor antagonist. It can effectively alleviate monocrotaline (MCT)-induced PAH in a rat mode ...