We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C182H282N54O52S4 |
M.W/Mr. | 4186.84 |
Sequence | EIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCWQV |
Length | 35 |
1. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
4. Implications of ligand-receptor binding kinetics on GLP-1R signalling
Required fields are marked with *
×Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
USA
Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA
Tel: 1-631-624-4882
Fax: 1-631-614-7828
Email: info@creative-peptides.com
Germany
Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main
Email: info@creative-peptides.com