Nesiritide Acetate
Nesiritide Acetate is a brain natriuretic peptide secreted by the human heart in response to cardiac volume or pressure.
Online Inquiry
| CAT# | 10-101-262 |
| CAS | 114471-18-0 |
| Synonyms/Alias | Brain Natriuretic Peptide-32; BNP-32 |
| M.F/Formula | C143H244N50O42S4 |
| M.W/Mr. | 3464.1 |
| Sequence | One Letter Code: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Three Letter Code: H-Ser-Pro-Lys-Met-Val-Gin-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-lle-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH (Disulfide Bridge Cys10-Cys26) |
| Appearance | White to off white powder |
| Purity | ≥98% (HPLC) |
| Activity | Agonist |
| Biological Activity | Nesiritide acetate is an agonist of natriuretic peptide receptors (NPRs), with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively. |
| Source# | Synthetic |
Storage | Store at -20°C. |
Solubility | Soluble in water, acid. |
Shipping Condition | Shipped at room temperature |
Write a review
Ask a question
My Review for Nesiritide Acetate
Required fields are marked with *
×
Ask a Question for Nesiritide Acetate
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
