Mambalgin-1 is a blocker of ASIC1 channels. Through inhibiting acid-sensing ion channels (ASICs) expressed either in central or peripheral neurons, Mambalgin-1 is able to abolish pain, thus it acts as an analgesic.
CAT# | R0971 |
CAS | 1609937-15-6 |
M.F/Formula | C272H429N85O84S10 |
M.W/Mr. | 6554.51 |
Sequence | LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK(Modifications: Disulfide bridge: 3-19, 12-37, 41-49, 50-55) |
Labeling Target | Acid-sensing ion channels (ASICs) |
Appearance | Lyophilized powder |
Purity | >98% |
Activity | Inhibitor |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Foreword We live in a photoshopped world, where we are constantly updated by images of digital perfection. It's easy to becom ...
Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...
What is palmitoyl hexapeptide-12? Lipopeptides, also known as acylpeptides, consist of a hydrophilic peptide bond and a lipo ...
DAPTA (D-[Ala]-Ser-Thr-Thr-Thr-Asn-Tyr-Thr-amide), D-Ala-Peptide T amide, is one of analogue of peptide T, which ...
Taltirelin is a thyrotropin-releasing hormone (TRH) analog that binds the brain BRH receptors in vivo. Taltireli ...