CAT# | A13275 |
M.F/Formula | C195H300N54O56S1 |
M.W/Mr. | 4329.0 |
Sequence | DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Lecirelin, a synthetic hormone, is a strongly basic nonapeptide with sequence yr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-A ...
Eledoisin is an undecapeptite of mollusk origin, which was first separated from posterior salivary glands of two ...
Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...
of skin aging Skin aging is the obvious external manifestation of a natural process occurring in tissues and or ...