CAT# | AF2892 |
Sequence | LEEAASSDTPVAAYQEMSMESRMMPDHVRQKRQSHLSMCRW |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Gonadorelin acetate, a synthetic decapeptide with sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2, is a gon ...
Teicoplanin is a glycopeptide antibiotic developed after vancomycin for the treatment of Gram-positive (G+) cocc ...
Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...
Gonadorelin hydrochloride, with the same amino acid sequence as endogenous gonadorelin, which is Pro-His-Trp-Ser ...
Deslorelin acetate, marketed under the trade names Ovuplant, SucroMate and Suprelorin, is an injectable gonadotr ...