CAT# | AF1968 |
Sequence | RCICTTRTCRFPYRRLGTCLFQNRVYTFCC |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Glutathione (γ-Glu-Cys-Gly, GSH) is the most abundant antioxidant in animal tissues, at 0.1-10 mM, as well as i ...
Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...
Resveratrol is also known as stilbene III. Its chemical name is (E)-3,5,4-trihydroxystilbene. It is a non-fla ...
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...
Proteolytic Processing of APP Following discovery of the full-length APP cDNA clone, numerous studies were undertaken to dete ...