Keywords Search Google Search Search

[Gly22]-beta-Amyloid (1-40), Arctic Mutation

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	A13255
M.W/Mr.	4257.8
Sequence	DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV

CAT#	Product Name	Inquiry
A13267	[Gln22, Asn23]-beta-Amyloid (1-40), E22Q/D23N Dutch/Iowa double mutation	Inquiry
A13303	[Asn7]-beta-Amyloid (1-42), Tottori-Japanese Mutation	Inquiry
A13274	[Lys22]-beta-Amyloid (1-40), Italian Mutation	Inquiry
A13305	[Lys22]-beta-Amyloid (1-42), Italian Mutation	Inquiry
CAD-004	(Cys0)-Amyloid β-Protein (1-40)	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of Tat-NR2B9c in neuroprotection

The peptide neuroprotectant Tat-NR2B9c, also known as NA-1, is a Tat peptide consisting of the nine C-terminal ...

UT receptor peptide antagonist-UFP 803

UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...

Brief information and effect of bradykinin

Overview of the kinin system Kinins are peptide hormones that are formed as part of the kinin-kallikrein system (KKS). kinin ...

Progress of Clinical Research on Trofinetide

Development of Trofinetide Trofinetide was found in 2002 by Brimble's team at the University of Auckland i ...

Function of Mifamurtide in Osteosarcoma

The immunomodulator mifamurtide (liposomal muramyltripeptide phosphatidyl ethanolamine [L-MTP-PE]) is a syntheti ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: