GLP-1/Glucagon-Like Peptide, amide, human

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	G16009
M.F/Formula	C184H273N51O57
M.W/Mr.	4111.5
Sequence	DEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

CAT#	Product Name	Inquiry
G16001	Glucagon - Like Peptide 1, GLP - 1 (7 - 17) - Cys	Inquiry
10-101-59	Liraglutide	Inquiry
G16006	GLP-2, human	Inquiry
G16033	(Asp28)-Glucagon (1-29) (human, rat, porcine)	Inquiry
G16014	(Des-Thr7)-Glucagon	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Very Late Antigen-4 blocker-BIO 1211

BIO 1211, is a non-covalent, small-molecule, cyclohexanecarboxylic acid base compound, tight-binding inhibitor ( ...

Comprehensive effect of angiotensin II acetate

Angiotensin Ⅱ is a kind of peptides generally produced by the hydrolysis of the angiotensin Ⅰ under the angioten ...

Function of Huwentoxin-XVI in analgesia

Ornithoctonus huwena, Chinese tarantula, is one of the most venomous spiders in China, and its venom can kill in ...

Pentagastrin functions as diagnostic aids

Figure 1. Chemical structure of pentagastrinPentagastrin, known as peptavlon, is a synthetic pentapeptide that p ...

Function of NFAT inhibitor

NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: