GLP-2 (1-34), Glucagon-Like Peptide-2 (1-34), human
GLP-2 (1-34), Glucagon-Like Peptide-2 (1-34), human
Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.
Online Inquiry
| CAT# | G16032 |
| M.W/Mr. | 3922.6 |
| Sequence | One Letter Code: HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
Three Letter Code: H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg-OH |
| Storage | -20°C |
References | 1. Yusta, B. et al. J Biol Chem 274, 30459 (1999)
2. Drucker, D. Gastroenterol 122, 531 (2002). |
Write a review
Ask a question
My Review for GLP-2 (1-34), Glucagon-Like Peptide-2 (1-34), human
Required fields are marked with *
×
Ask a Question for GLP-2 (1-34), Glucagon-Like Peptide-2 (1-34), human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
