We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy
Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 3922.6 |
Sequence | One Letter Code: HADGSFSDEMNTILDNLAARDFINWLIQTKITDR Three Letter Code: H-His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg-OH |
References | 1. Yusta, B. et al. J Biol Chem 274, 30459 (1999) 2. Drucker, D. Gastroenterol 122, 531 (2002). |
1. The spatiotemporal control of signalling and trafficking of the GLP-1R
2. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
3. TMEM16F and dynamins control expansive plasma membrane reservoirs
Required fields are marked with *
×Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
USA
Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA
Tel: 1-631-624-4882
Fax: 1-631-614-7828
Email: info@creative-peptides.com
Germany
Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main
Email: info@creative-peptides.com