Exendin-3 is a biologically active peptides isolated from venoms of the Gila monster lizards, Heloderma horridurn .
CAT# | R1347 |
CAS | 130357-25-4 |
M.F/Formula | C₁₈₄H₂₈₂N₅₀O₆₁S |
M.W/Mr. | 4202.57 |
Sequence | One Letter Code: HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 three Letter Code: His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Long-term potentiation (LTP) is a persistent synaptic enhancement which is thought to be a substrate for memory. ...
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...
P11 (HSDVHK) is a novel peptide ligand containing a PDZ-binding motif (Ser-Asp-Val) with high affinity to integr ...
C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...
The 70-kDa heat shock protein (HSP70) contains three domains: the ATPase N-domain, which hydrolyses ATP, the sub ...