CAT# | AF2984 |
Sequence | ATYYGNGVYCNKQKCWVDWSRARSEIIDRGVKAYVNGFTKVLG |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino aci ...
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
Delmitide, also known as RDP58, is a novel D-amino acid decapeptide with anti-inflammatory effect. RDP58 is a te ...
Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...